PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Itr_sc000114.1_g00044.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Convolvulaceae; Ipomoeeae; Ipomoea
Family Nin-like
Protein Properties Length: 280aa    MW: 30416 Da    PI: 9.2134
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Itr_sc000114.1_g00044.1genomeKazusaView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK621e-192066349
                   RWP-RK  3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRki 49
                             k++s++++sk Fslp+ dAA +Lgvc++vLK+iC ++G+ RWP+Rk 
  Itr_sc000114.1_g00044.1 20 KSLSFDEVSKLFSLPLSDAADTLGVCTSVLKKICYENGLVRWPYRKF 66
                             789*******************************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151915.323288IPR003035RWP-RK domain
PfamPF020422.8E-182266IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 280 aa     Download sequence    Send to blast
MSAVQISNPG SNPNIKTDPK SLSFDEVSKL FSLPLSDAAD TLGVCTSVLK KICYENGLVR  60
WPYRKFLSGK SIEEIKKDAA KEKQEQHAEL PKPAGEKPNL PANSTPSTSK GSPLQNKGSS  120
AGQEMPKSAA ASQQQGSKTA QTLSSQHLLS VNLPKGTTAG SDEFKYGFPS DGLSAISYKW  180
WGSRSTDANE DTKKEGNAEE SKQQSAVPMD ESAVKTDKSN VDSFGADSLS DLRKQAAKEG  240
KEALKLGVYR EHSLFKLDLT KRKVLLQVFK SAYPPQWEQE
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009766294.11e-106PREDICTED: protein NLP2
RefseqXP_016432827.11e-106PREDICTED: protein NLP2-like
TrEMBLA0A0V0HW324e-94A0A0V0HW32_SOLCH; Uncharacterized protein
STRINGPGSC0003DMT4000202963e-93(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA107441921
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G17150.13e-09Nin-like family protein